DPCstruct | MC10361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 73 ± 10 aa |
| Standard deviation of domain lengths | 10.00 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 57.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2RZB9 | 1-84 | MPTPLDKALQSKNLLVGFVGLVTAAAVWSIWGSEMFPAEADPTGDPEYWTFDELRRWLRARGLLPNEQASREELLERVKANLRP |
| A0A364LST0 | 1-66 | MPTALDRAMHSKNLFLGFAGMVTAAAAWAIWGSDIFPAESDPTGDPETWTVEEMKRWLSNVCAFFT |
| A0A0F4YK55 | 1-66 | None |
| A0A384JIK9 | 1-85 | None |
| A0A544ZVH4 | 1-79 | None |
| A0A420HLJ3 | 1-60 | None |
| A0A4V5NGU0 | 1-64 | None |
| A0A218ZCA4 | 1-63 | None |
| A0A2L2TSW6 | 26-111 | None |
| A0A5J5EWH3 | 16-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.