DPCstruct | MC10360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 185 ± 45 aa |
| Standard deviation of domain lengths | 45.44 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 79.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8AJ43 | 3-121 | QKSLSLDQIVEKLIETSKIVENRMGLKSQEEVRVKDAFSLLASRRCSVKKKPYLELLQRVHKRIGGYGVVLCAAIGPTMILALKDRD… |
| A0A0D1ZHM9 | 5-161 | LDSQQTSDESDEVAKTCKLLHATMKRMRTRDRLSGRSPRLVREAVDILKTPQTGRDNLVYQEFLCDVLHNCGRGVTLLCAASLGKFR… |
| A0A162MVE1 | 1-161 | None |
| A0A0F4YUQ7 | 3-174 | None |
| A0A2V1CY27 | 1-144 | None |
| A0A1M3T0F2 | 54-215 | None |
| A0A395GWA3 | 5-169 | None |
| A0A4Q7JZ75 | 11-207 | None |
| A0A5N6TKT1 | 4-155 | None |
| A0A0F7ZI93 | 5-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.