DPCstruct | MC1036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 169 ± 17 aa |
| Standard deviation of domain lengths | 16.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2LHR0 | 10-160 | LNYGSVEEAQLDGAYVTHNGHCGACSTLQDLSVYMQYTDLTAPVRKCGLEGILSKQLAMDCLLALGFSNPCAEIWYDNTVNTREDCF… |
| A6FXF9 | 157-314 | PDSVCGVVLGADSYAMATYADEASAAADGAHVTHRGACGQCSSLANLAVYMRMPDLTEPVRQCGLDGIVQGEEANIQCLMDLGFDEP… |
| R1BXB4 | 332-494 | None |
| A0A835YBJ5 | 47-220 | None |
| A0A7S1UWS2 | 126-314 | None |
| A0A7S1V2C7 | 32-208 | None |
| A0A061RHZ8 | 22-191 | None |
| K0TJU9 | 228-401 | None |
| R1BW60 | 109-279 | None |
| A0A7R9W9P1 | 159-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.