DPCstruct | MC10359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 262 ± 46 aa |
| Standard deviation of domain lengths | 45.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G5JXW5 | 1-166 | MKEPKPLSRKQQRTKESRHLQDQTARRHPDATSILSRPRTVVSGKRRVPVLVNARGVPFLRIKKPQPKNLSGVIRSKLENRWSRIER… |
| A0A0D1Z0R7 | 22-337 | RALLKQCAEFPTASPESLASPSKTVQTLQSLVRYRFRRDRALSSPFSIINGLDTGNRVLSLLQQCTLKSPVALSQLSTLLGSISRRA… |
| A0A077W9X5 | 19-275 | None |
| A0A0G4MMC2 | 1-289 | None |
| A0A4Z1J032 | 1-225 | None |
| A0A4U0V5A0 | 22-303 | None |
| A0A0M8N3J5 | 1-325 | None |
| Q2GRU9 | 15-301 | None |
| U7PN64 | 5-341 | None |
| A0A261Y2T2 | 3-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.