DPCstruct | MC10358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 236 ± 33 aa |
| Standard deviation of domain lengths | 33.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1HIW3 | 5-228 | KATSTSDKMKERMAKLKNLHNVRNEARNQNHSEVKKEMERMTLPKNWDIRQQKAEWLIKDKANRDDAEEKGMDYDRVKLLNVSAQDQ… |
| A0A0D1WMD7 | 61-328 | TPASKVTTATPSSSTNTDRLARFAALKSRAAASSKSNLAETKAEANRAAVDPTVLANLARRSAIASHNLLKADTEEEGGEGAFERKR… |
| A0A177WHZ8 | 105-352 | None |
| U7PY02 | 126-389 | None |
| K5WBU4 | 25-295 | None |
| Q6CFW4 | 4-195 | None |
| A0A0C3DZE6 | 1-190 | None |
| B7GDL3 | 9-235 | None |
| A0A811VAE5 | 2-156 | None |
| A0A4S8JN56 | 131-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.