DPCstruct | MC10357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 185 ± 33 aa |
| Standard deviation of domain lengths | 33.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | PF20415- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0VYQ1 | 1-146 | MSTASSEPPIALRIPPELWVLVSEELDYVQLKRLSGVCKAFKAMLEQPHYSLRLFTKPPTGQLQPGTHLATHPMLDGLDLIRCEDTG… |
| A0A1V8TVA1 | 2-178 | TSPTPFRAASEVFAIPELLEMILTESHMHDVLVWQRVDKTFNGVVANSRTLQEKLHFRAIFSEGEDPPEAVLNDLLHDHFDRCLWSE… |
| A0A5N6G088 | 2-170 | None |
| A0A194VHP0 | 2-161 | None |
| A0A4S9LYU9 | 527-665 | None |
| A0A1V8T0D3 | 89-292 | None |
| A0A318YDA8 | 2-171 | None |
| A0A4V5N736 | 1-222 | None |
| A0A194V123 | 4-196 | None |
| A0A3N4KSH3 | 59-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.