DPCstruct | MC10356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 162 ± 30 aa |
| Standard deviation of domain lengths | 29.71 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.52 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0036- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9YIN8 | 109-264 | AGPVWLIGTASEHHVLYQYNIAGASDHYMGLIQTESPYYQPTPAPPSPFSIDSAYVDPSFPSDLTAAWGLYIQSSTDILVFGAGHYS… |
| A0A1V8TR94 | 617-799 | TVYTGRGMLVESSGPVWLVGTAVEHNVLYEYQFVKASNVFGGQMQIESAYYQPNPPAPIPFPYVASLNDPQFPVATITADGYVIPAS… |
| A0A0A1T705 | 2-111 | None |
| B0XST0 | 599-782 | None |
| T0LMM2 | 425-598 | None |
| U7Q190 | 797-958 | None |
| U7PVI3 | 4-135 | None |
| U7PQ26 | 1126-1300 | None |
| A0A165V1X1 | 249-402 | None |
| J3PE45 | 546-837 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.