DPCstruct | MC10354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 171 ± 52 aa |
| Standard deviation of domain lengths | 52.20 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 72.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10338 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V8TN33 | 37-198 | TIAAWDTRTSTLPSPTEPPAFTPAAPFRPLFALVTDPLTGEVHHPTVHYVFSDDEADGSPLTAAALQAIEDQEDATLSGAGEVEERV… |
| U4LRY0 | 151-300 | QQSHPQYGQQSHQQSYPPPSPPPPPPFQPLFTLITPTASELAHPHPNVHYIFADDVDPTLDLPPANPQERVITVDMDFDANGRPYVK… |
| A0A3N4KLI6 | 17-162 | None |
| A0A146HPD6 | 1-126 | None |
| A0A1Z5T858 | 1-226 | None |
| A0A0B7NAV8 | 9-166 | None |
| A0A1J7JKI9 | 39-313 | None |
| A0A6A6GFP2 | 29-197 | None |
| A0A167DXP8 | 1-181 | None |
| A0A2H2ZKQ4 | 117-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.