DPCstruct | MC10351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 299 ± 54 aa |
| Standard deviation of domain lengths | 54.04 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 39.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13298 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6WQH6 | 41-360 | FAGLYQKNQHAHGNHFVIHQHNHPRAGVHYDLRLQFSKTSSLSFAVPKGLPGDPNSKQQGRMAIETRVHNLWNHLIESASLKTGSLL… |
| A0A1V8TKA1 | 39-276 | IWDTGEYEVLPSRKVRRQAATDDEDSDCSESDSDSRGASEKLSASFRARHIRLRLHGTRLPSQYTVNLRLPSANNREHQPDRPKHKR… |
| A0A4Q4XYR9 | 155-430 | None |
| A0A167UFA9 | 1-269 | None |
| A0A4Q4YXX3 | 188-488 | None |
| W6QA41 | 727-1022 | None |
| A0A4U0WJS3 | 32-294 | None |
| A0A0D2XAS0 | 3-215 | None |
| A0A094END2 | 725-1049 | None |
| A0A167Z2J6 | 141-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.