DPCstruct | MC1035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061QPC1 | 4-117 | VADRGLQPSQWTSARLRGEVLFLESHSARYEVSHVERAQSADESAEEDLFRWSRCKRNLSLAQMRKVGLPMPESMLEVLEPALRWED… |
| A0A6B2LF02 | 2-136 | FPSTIILYNLSQEPCLKYDFNLICDRGVNCTHWTSFKLKSTVLFLENFNNRFELSREEFPLSTGFDAYRWAKVLKPFHLTRDLLSKV… |
| G0QZ94 | 7-148 | None |
| R7Q7C8 | 113-264 | None |
| A0A446PIN8 | 276-441 | None |
| M1V7N9 | 427-580 | None |
| A0A287KFY8 | 174-341 | None |
| A0A1D6Q0L7 | 214-386 | None |
| A0A834ZQU4 | 3-176 | None |
| A0A0M0K9M6 | 76-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.