DPCstruct | MC10349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 452 ± 67 aa |
| Standard deviation of domain lengths | 66.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.12 |
| Pfam Score | 96.00 |
| Assigned Pfam label(s) | PF05183- CL0221- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7M8P4 | 2-380 | SNTIQVYGYPTLESADVIKISLENYTGLGTIHALEVKKSNRGSRSYAKVQFTTRERVEYVLDLANHKRLRFGTTYLKAYVMDRDIVQ… |
| A0A1V8T9W3 | 1-505 | MDVIVRNVPANVSVRQLKAAFAAPLAECGIHDYHCEPFRNHPLAKITVLDSAVGDRFLSQYGVLARSPANARPRKSINCGGRTLRCG… |
| A0A6V7P7T0 | 37-435 | None |
| K1PWF8 | 674-1098 | None |
| A0A0A1T4Y7 | 1-512 | None |
| A0A0G4L5B2 | 51-511 | None |
| A0A820YT59 | 70-456 | None |
| A0A822D053 | 103-543 | None |
| G2YY25 | 26-549 | None |
| I1CD10 | 192-760 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.