DPCstruct | MC10346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 170 ± 27 aa |
| Standard deviation of domain lengths | 26.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517S9Y2 | 19-171 | KPTREYERWVKPDGFDHVDFHEVLYGSDFIFVLDWRAALEDELERIVHALGKLDVVMDFEIDDSDSRCGIAVVTVERRPATVRYSGN… |
| A0A095Y610 | 8-165 | QNIIATLQRLGLELRNPAAICAGEYEAYFILTAKDDDYRPAFSHVLAYDTEMIEEDDSYTGWVHDWARATGKQDRVTDVAAHVDFDD… |
| B4D9X7 | 8-138 | None |
| S6A3S6 | 17-160 | None |
| A0A258H3N8 | 88-279 | None |
| A0A7W4FLD0 | 21-182 | None |
| A0A5K7XGM4 | 115-259 | None |
| A0A2R7SDL5 | 9-183 | None |
| A0A519NA98 | 14-175 | None |
| A0A7W4EXW5 | 4-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.