DPCstruct | MC10345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839TH77 | 1-84 | MKEYNGWTNYATWNVNLWLTNDESSYNYWMERARDSEVNELAVALEDEHKEAMPELDSSTYSDLLQHVLGSVNWHDIAKSLIEG |
| A0A517S9J4 | 1-106 | MDDTTYNGWTNYETWATALWLDNDAGSYAFWNAEARDCWEAAPASQHVRELGFSRGKAATLELGNRLKSAIHDQSPELGACLYSDLL… |
| A0A7G9Y0N4 | 1-87 | None |
| A0A354P6Z5 | 33-123 | None |
| A0A1G0I759 | 15-128 | None |
| A0A399XUW0 | 6-93 | None |
| A0A7V9V036 | 1-92 | None |
| A0A0F9FQE6 | 31-133 | None |
| A0A2T5G4C2 | 1-84 | None |
| A0A1F3NNV9 | 3-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.