DPCstruct | MC10341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 206 ± 16 aa |
| Standard deviation of domain lengths | 15.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812IRN1 | 385-598 | HQREMVRRGQQAIFMCNGLFTSNRTLEQVFATELAFLPDPVGTPEGGDYTVDWERKAVEIGAPGAVPTMRAAFREGIGCISLPPDQT… |
| A0A3F2V0E1 | 8-232 | TTLLSVFFLALISTLGLHGCSLRHEIPIASGYAAKNICSDYFVSGLDPRTIKVRLVGPQIKPFDKIWRIDIDEDKKNVAVSDIIFGN… |
| A0A521YNM2 | 242-432 | None |
| A0A4V1LT11 | 27-211 | None |
| A0A426PXT5 | 1-200 | None |
| A0A800F0C9 | 2-212 | None |
| A0A2E8E3D8 | 30-233 | None |
| A0A6F8NCB0 | 36-259 | None |
| A0A3N1KRF5 | 19-202 | None |
| A0A813ANW5 | 36-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.