DPCstruct | MC1034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 173 |
|---|---|
| Mean domain length (aa) | 281 ± 54 aa |
| Standard deviation of domain lengths | 54.09 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.71 |
| Pfam Score | 91.26 |
| Assigned Pfam label(s) | PF02145- PF21022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455B0B8 | 1-162 | FRGGLDVTHGQTGVESVYTIFRDREIMFHVSTKLPFTEGDTQQLQRKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQAENP… |
| A0A6B2L9J1 | 27-298 | HLRMKKEDLRFTVESKKLKRKKQAIEAILKSKNFKFQSLKRIKDPKFTTDIISFEEKFIMKHYKVGVLYCKEGQKDQREMFSNERAS… |
| A0A482WVE6 | 83-418 | None |
| A0A368FFI5 | 233-445 | None |
| A0A1A9VUM8 | 4-187 | None |
| A0A6I8PSN7 | 85-448 | None |
| A0A0K0EHQ4 | 1435-1701 | None |
| A0A397EJ61 | 31-278 | None |
| A0A672UJ54 | 18-261 | None |
| K7F6Q9 | 223-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.