DPCstruct | MC10336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 13.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.04 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0123- PF20239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8FGV7 | 4-102 | IGAIRARTEHSDPHPVRDDELRMMFTCAHPALDRQSQLALTLRLVSGLTVTEIARALLQTDAAIGQRITRAKNKIRHANIPLRVPPA… |
| A0A7W7SJW8 | 1-123 | MDQVRSEQARRRREERTALATPQAEQLSHAADADPHQDRDDSLALLFPCRHPALSEPSRTALTLRAVGGLSTSQIAAAFLAPKATTP… |
| A0A2E4HCY0 | 24-117 | None |
| A0A178U656 | 742-873 | None |
| A0A7W9HL63 | 55-173 | None |
| A0A538N1R6 | 1-118 | None |
| A0A0K2RC23 | 5-112 | None |
| A0A6G0ZZ46 | 1-134 | None |
| A0A538RH80 | 58-187 | None |
| A0A5N6MH60 | 62-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.