DPCstruct | MC10333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 8.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8EIA5 | 1-90 | MTRPSPAAALNGVQVGNICDKGNHRIRTGDIAVVYATYYDADGWVVRRVMCDCGSRTIGLPTDGADEVIVEAVWWAGRLVGVKTVDR… |
| L9XNR3 | 6-108 | TPTQLLEGLSVGTQGSTHCQWCDYEFYEGDTATVLISRPADADCWIVHRAYCASCDPSAIAGPTLGCTELLARCRLGTRADLAAQQT… |
| M0NGW0 | 12-119 | None |
| A0A6A9T4C7 | 46-146 | None |
| A0A1H9EUC5 | 21-132 | None |
| A0A5N5UKR2 | 1-92 | None |
| U1R1J2 | 9-118 | None |
| A0A6B0GGM6 | 3-89 | None |
| M0NFH6 | 24-115 | None |
| A0A558GDI5 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.