DPCstruct | MC10331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 193 ± 25 aa |
| Standard deviation of domain lengths | 24.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7A6F8 | 13-235 | LRRAMRDYPLYDPPHKVEEYLLSREQATENFDYFMRVRLERFAYFQNWLRRYFWVAITSDERGVKALSRWGNRYAGLLLVIGPDGDP… |
| A0A7J5AUQ1 | 3-177 | ILDAYEIYDPGVSGLWKNLSRGEAARAVRRLLADRPRRLQELRRLAERAEIELPEPQDATDGQLQGLSQWFFANLERDGRSSARLAP… |
| A0A4R7C5N5 | 263-471 | None |
| A0A2S8ZM60 | 4-173 | None |
| A0A0T5P4C3 | 6-175 | None |
| R7WHJ7 | 517-704 | None |
| A0A4Z0HS96 | 17-223 | None |
| A0A7X6QZH7 | 5-171 | None |
| A0A679JY91 | 17-215 | None |
| A0A5C4K4C3 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.