DPCstruct | MC10330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Standard deviation of domain lengths | 7.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6Q6C5 | 4-91 | KLGDLSPFRTIVTDTAALVDKGDLAGAKARIKDLETSWDEAEAGLKPRAAAEWHKVDKAIDRALEALRASTPNAATCKQSLSDLLAVM |
| A0A7K2Q9M7 | 2-77 | ADTLAKVNAGDQRAATSRVKDLETAWDDDQSTLEPKSEKAWSSLDGEIDQVLKALRAPHPDKAGEVSALNTLLTSL |
| A0A1H6ZC08 | 55-146 | None |
| A0A1H9TAM6 | 49-138 | None |
| A0A1Z4EN05 | 7-98 | None |
| A0A2K8PB81 | 7-88 | None |
| A0A2R7QRF2 | 6-96 | None |
| A0A1G8IIS6 | 644-740 | None |
| A0A1W9XPY1 | 29-129 | None |
| A0A4R7W919 | 25-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.