DPCstruct | MC1033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 297 ± 34 aa |
| Standard deviation of domain lengths | 33.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08578 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4PGS5 | 23-295 | NPLIWWHVPGYTLLTRELLRIMERSSTSDDREAEFSKASSKFLLTDPELLSEYLSIVIPRTSAHSEKAVMHLFECLGEWWKTLKENS… |
| A0A6B2L9A0 | 61-332 | VDWRSINGFYQFLDVFLYILQHYPPNSKTFSNLMTSMIRCEPKLLNYYLRISLSRTPLNNIPLVAASLAKIQSWFNEFGVLGLPIPP… |
| A0A015L6M6 | 256-540 | None |
| A0A7S3IBI7 | 289-558 | None |
| M7W3R9 | 62-419 | None |
| B0EKL7 | 364-707 | None |
| N9V5N8 | 5-288 | None |
| A0A7S3IAK9 | 67-359 | None |
| A0A2P6N4Z3 | 415-735 | None |
| A0DHQ2 | 4-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.