DPCstruct | MC10329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 204 ± 20 aa |
| Standard deviation of domain lengths | 19.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5F1S4 | 1-176 | MTPKEKEDTDIKEYAQQVLDSKRWVNTSIDLLDSIKSLEPIVRNRWDNFNNMKGDVRSLMIHKTFFFLLGLSIENLLKSRIVKYNQS… |
| A0A1M6NN37 | 1-207 | MSNQPEDSFLRQNFKYYQEWHHWLGKADKLKRAALILYNADLPDLRLYDHAYKKALEEIGEEGKAPVSHPHPDMLPAFSLFGSALEN… |
| A0A259TVE3 | 1-200 | None |
| A0A177MSF5 | 1-210 | None |
| A0A843K4F6 | 6-187 | None |
| A0A4Q2IYK8 | 1-220 | None |
| A0A2V5YEG2 | 1-192 | None |
| A0A4S5JGP8 | 11-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.