DPCstruct | MC10328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 305 ± 42 aa |
| Standard deviation of domain lengths | 41.71 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H2C7P4 | 149-416 | GWRWFAPDGRVRRGGRRHPRPHWEAEVDTLVRHAAPGVRAYAVPAGIWLFTDAPHLPEPGLDDLVLAVPMDRDRVTVVLGRPGTPPP… |
| A0A166T360 | 1-295 | MSGHATRRNSTPPTGQPDVTAVPAGWWVRPAGSGAADPMDPAFAALPDPDGATTVIVGAAGGPPPPASAVAAFLLAMAPARQDDVIV… |
| Q0RKP5 | 125-497 | None |
| A0A285KB80 | 1-256 | None |
| R4L9Y7 | 165-530 | None |
| A0A1H0QNQ1 | 151-460 | None |
| A0A286EVL8 | 75-323 | None |
| A0A0Q0XEN7 | 4-303 | None |
| A0A1H2CVV8 | 19-281 | None |
| A0A542XKR7 | 1-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.