DPCstruct | MC10327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9FZI0 | 1-88 | MATYKKVSHRHIRKETDLVVTLIEGIGGPCAFITDPAQGRDTIPIPVEEALAGARQVIAGEPRPRDIVIVDEDDLWDERWGTLAPHPE |
| A0A3S0HBZ3 | 10-105 | KKRPRYTLLDDPGSAAGNEIIVTIFDWQGKAPIRATLGWMAHSREGAHVGPDESEEVDVGLALAQAQRLLQRYGFRRIVIVLEHEDL… |
| A0A0F5FMI2 | 148-252 | None |
| A0A849I7Z6 | 2-95 | None |
| A0A0F5PZR6 | 1-107 | None |
| A0A4Q8XNR7 | 37-129 | None |
| A0A2P7BC62 | 24-116 | None |
| A0A1E4E0V3 | 34-139 | None |
| A0A3S0S8J5 | 4-96 | None |
| A0A318B4S1 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.