DPCstruct | MC10324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4B0Q1 | 4-60 | FPEWAVWRSDAGRVWATLRRGLTGEEWEAGCSRTVDGDDARRLAEALEEQRRRQAEA |
| D6Y291 | 1-72 | MDLEQIAAKYPGWVIWRGASEAGPGAWYATRRGTSLSYEQLNAGLEQTVCGDDASALVVELERQAKIAARLA |
| A0A1H6CY30 | 32-103 | None |
| A0A544YKN7 | 2-66 | None |
| A0A495QH59 | 5-61 | None |
| A0A6N7I631 | 14-84 | None |
| A0A372JP70 | 1-65 | None |
| A0A7K1L784 | 1-80 | None |
| A0A4R4VQG4 | 43-110 | None |
| A0A7X0IKB1 | 4-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.