DPCstruct | MC10322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 219 ± 38 aa |
| Standard deviation of domain lengths | 38.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258IWL1 | 2-206 | RLHERSFPAVGEEVEAEIGQPVMILERYYAGQSLRLLEPIKSGSALGNKIVLAPGLYALAVENDKGRYYEAVGGVTLNALGMNMPWP… |
| B9M6S2 | 18-225 | SSLHPTLKKLDTLEPGVVKTAALGGTMYETGYIRALPGFVASTNYYLPEMDNLVFPPVKKGTVWVCNGKLSSGDYLCLCPDISEKDV… |
| A0A2D7XTI3 | 15-288 | None |
| A0A1F9IT22 | 1-269 | None |
| A0A348VS19 | 7-258 | None |
| A0A657APL3 | 9-203 | None |
| J2Q3N5 | 152-375 | None |
| A0A550JVX5 | 4-235 | None |
| A0A6I5X0M3 | 1-278 | None |
| A0A1I3U1S5 | 286-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.