DPCstruct | MC10321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Standard deviation of domain lengths | 5.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9M2R9 | 1-57 | MKKTAKHFCPHCQKEVSWQDNPHRPFCSERCKMIDLGSWFSENYKIPGEKKPSEDED |
| A0A2A9FQ05 | 1-55 | MNVECPTCRKTVKWTDANPERPFCSHRCKLIDLGAWANEEYRVPAQNVSSEDLDQ |
| A0A1G3H7W6 | 1-51 | None |
| A0A7V3H3Z6 | 1-61 | None |
| A0A7X7YV07 | 1-62 | None |
| A0A377DXB6 | 1-58 | None |
| A0A803GCY0 | 1-51 | None |
| A0A354W5S3 | 2-57 | None |
| A0A1Z9YGM4 | 15-76 | None |
| A0A7R9AIB6 | 260-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.