DPCstruct | MC10320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 11.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V7BPT6 | 10-161 | PTFEQSLEVWRKLLDDRNLPTELVWIYDENLVFERDGESGFRLGYQTHFTPPPPEAERITFDYFCEFEARMAYYRLGSNRGRSVCLM… |
| B9M2H9 | 22-148 | QNLPAFEDAEAQFQEFLKTVEWPGELIWICADDVAVSGDILIVHPNKEGREQAIRGYKRGIKKHLGILLNAICRDDFRTYCAVWNPS… |
| A0A142X090 | 10-155 | None |
| A0A2A2I1H6 | 4-131 | None |
| A0A2V8YBS4 | 48-183 | None |
| A0A3A8PI44 | 5-165 | None |
| A0A518CWC5 | 168-297 | None |
| A0A6N4T387 | 1-135 | None |
| A0A517N285 | 129-251 | None |
| A0A353C6R2 | 173-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.