DPCstruct | MC1032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 257 |
|---|---|
| Mean domain length (aa) | 304 ± 66 aa |
| Standard deviation of domain lengths | 66.00 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.86 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | CL0016- PF12417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818UM20 | 53-278 | VEALQLGIQYTVGGLQAKAAHDVLYQDFLTVEIIHFPKEGTKTTPAHRFNDFTIRSYAPVAFRHFRELFNIRPDEFLYSICKPLREL… |
| A0A6B2L7T9 | 24-331 | EPNRKLGIEFADYNRTVTHEVTYPNNVKLSIQEICPSIFGDIREMNKISQISLLKEWDIPQDKLTASESSGKSGSIFILSNEKSFMI… |
| A0A6D2JCJ9 | 206-589 | None |
| C3ZJN0 | 16-351 | None |
| H0ETX6 | 4-376 | None |
| A0A7S3JEQ7 | 213-445 | None |
| A0A397FJJ0 | 266-617 | None |
| A0A7S0A764 | 2-312 | None |
| W5MAL5 | 93-530 | None |
| A0A0V0QVI3 | 54-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.