DPCstruct | MC10318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 57.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376W501 | 110-176 | PICVESCPLRALDFGPIDELRKKHGDLAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPKEV |
| G5LLV1 | 1-64 | MKSCPLRALDFGPIDELRKKHGELAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPKEV |
| A0A2X2BIH1 | 43-106 | None |
| A0A7C8BW12 | 56-115 | None |
| W1DCW9 | 17-79 | None |
| A0A090RFE3 | 7-68 | None |
| A0A0A2VYX2 | 940-1006 | None |
| A0A7Z8N029 | 49-101 | None |
| A0A509D5D9 | 57-112 | None |
| A0A377LWY8 | 38-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.