DPCstruct | MC10316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 105 ± 24 aa |
| Standard deviation of domain lengths | 24.47 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 71.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A117SFS7 | 2-114 | STVKAQEKAKMKVEKTEKAAFACPMKCEGEKTYDKAGSCPKCKMDLKKTETTKKPACCAGMKSDSAKMECGMNHDKMAEMYACPMKC… |
| A0A2V8G2V7 | 1-85 | MVDDKKGQCPICKMTLVPVRLALVWTCPVHSQISADAQGNCKQCGRPLVRVTKALSWTCPVHPKIDVLEPGKCPICKRTLTVKYT |
| A0A0Q0WQL7 | 15-106 | None |
| A0A3S0DMN9 | 112-174 | None |
| A0A2I0QCI7 | 68-166 | None |
| A0A0F9CYC2 | 67-158 | None |
| A0A3D2N627 | 1-116 | None |
| A0A521ALE9 | 13-105 | None |
| A0A1J4SP80 | 1-112 | None |
| A0A2D0NEJ6 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.