DPCstruct | MC10315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 366 ± 56 aa |
| Standard deviation of domain lengths | 56.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6PA39 | 3-263 | INNSYGEKKNAFTRLTPEDSSTFEKEKSCEILSTVSGRGPNGTQSIRFLSSAPTAKYYKGSWEKDIFASPFEKVEGWFALRFVDPLD… |
| A0A117E192 | 77-455 | GNHTGLHGKLRQYLHSQRLRDEEYPYVFLLTAPKVLGHVFNPVSFWYLYSINKTLAAVILEVNNNFGERHMYLLLSTGSTSGDTSVA… |
| A0A420U875 | 1-266 | None |
| R4X8A7 | 11-358 | None |
| R9PA03 | 246-737 | None |
| A0A2V1DJH0 | 85-486 | None |
| A0A146FT60 | 1-318 | None |
| A0A1L7VS37 | 198-479 | None |
| A0A397J2E9 | 141-564 | None |
| A0A4Y9ZA99 | 117-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.