DPCstruct | MC10314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 358 ± 61 aa |
| Standard deviation of domain lengths | 60.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A100INT3 | 239-597 | ELPVELLQSILAAAPDIKTLEAAVMTGPCLYNAFKGAEEFIVRPVILRQFDTDLLHDVLATHASSKIQDWSIDQAEKFLTPYFARDQ… |
| A0A2J6RTN0 | 2-393 | PDLPTLRSLVHASPILHAQYIYDRNSILRACLDRELDGFLVDAYANLMSRVRELGSPRTDEKITGFLDTYRDWLSGSIPRPYVNLID… |
| A0A4Z0YYS2 | 201-626 | None |
| A0A4Z0YJZ4 | 10-360 | None |
| E4UMY8 | 10-335 | None |
| A0A0F4Z0Z6 | 1-463 | None |
| A0A0F4YRG2 | 10-317 | None |
| A0A0F4YHT0 | 8-374 | None |
| A0A423VZP3 | 50-456 | None |
| A0A423VM74 | 37-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.