DPCstruct | MC10313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Standard deviation of domain lengths | 18.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4VWZ7 | 3-102 | GGGAMQWLRRWAYNASGFNKLGLWHDDCLYEDDEVKEAVRRLPERLQDDRTFRITRAMQLSLSHQILPREQWTTFDEDIRYLKPYLE… |
| A0A674A4G1 | 15-130 | GGMSLKEWQTALAATGRLLVGFRKWYYNAAGFNKIGLMRDDTIHEDGDVKEALRRLPEKVYNDRMFRLKRALDLSMKQAVLPKEQWT… |
| A0A1D6GF76 | 1-123 | None |
| A0A7R9AU30 | 77-215 | None |
| A0A158N898 | 34-158 | None |
| A0A6P5FKG1 | 4-106 | None |
| A0A4S2N4H4 | 8-117 | None |
| A0A7R9KKR7 | 3-122 | None |
| A0A267G9A2 | 19-137 | None |
| A0A5N5HND6 | 138-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.