DPCstruct | MC10312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 125 ± 10 aa |
| Standard deviation of domain lengths | 9.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4Y0E8 | 111-230 | LSLTDVYLGWYRSLGLRRNTRETVLTPDDQLVALQLCMAELNSQKIGSFEAQASDVLEVVSHLTQDKLGCLATTGGHAPRDDYQPIR… |
| A0A673ZRG0 | 1-128 | KYVFNEDSLKTVVRTFRRECLRVLESERTNIHGADGMLMVLQLAIAEVNKQESGEFSVALSDVQMAWKHLLLDKLHLPLYNDSSRPE… |
| A0A6J0G976 | 1-130 | None |
| A0A670YR93 | 1-125 | None |
| A0A7R8X8M8 | 25-125 | None |
| A0A6P8HXW7 | 70-175 | None |
| A0A834AYJ1 | 1-127 | None |
| A0A2K6BRU4 | 5-135 | None |
| A0A667G8S0 | 1-127 | None |
| A0A6P7RBP0 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.