DPCstruct | MC10310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 12.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C7D957 | 130-222 | VPLFEKHLGPAFDVLPAEVRDSHVNTAPRRLIGRASVTRGPGFLPTLIAMLFRFPKAVDDVQVEVLKTSTPAGETWVRTFAHQSFVS… |
| A0A2V4Z6B8 | 6-103 | MVQQQSLYRRILGRDWDRVPASIRALHDRSEGHATFCGRAVVERGGSIWARLVASVFGFPSAGADVPVEIRFACGNGREIWTRRFGE… |
| A0A6L5DM53 | 3-132 | None |
| A0A2E2F3T2 | 71-163 | None |
| A0A1I2PTI2 | 149-285 | None |
| A0A1Q4FMA0 | 261-361 | None |
| A0A840Z9Z8 | 3-83 | None |
| A0A8B4XC94 | 23-123 | None |
| A0A815M6R0 | 86-180 | None |
| A0A2S1XPN1 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.