DPCstruct | MC10308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 182 ± 31 aa |
| Standard deviation of domain lengths | 31.03 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7B696 | 21-205 | RGNGNLTIAFFANDQQGSCDSNDTSDGLVLTTSSIPTGYTCFNLTDIFSQSNDTGFQNATSTVYDRNGEIIQPNGIDWLLQNRDSFD… |
| A0A0B7K1K6 | 30-217 | GNLTVAFFSNELGGSCDINATTNRLALTTQTIPNSYTCFNVSDIFSQSNTTGFTNATQHVYNTDEPNGIFWRLESEGSYDSQTNYSR… |
| A0A2H2Z2K7 | 4-209 | None |
| A0A2V1BTB8 | 17-246 | None |
| A0A5N5P8R7 | 31-203 | None |
| G0RBR3 | 26-221 | None |
| A0A4S9NJI0 | 1-161 | None |
| A0A074VV51 | 53-179 | None |
| A0A074VKZ1 | 22-187 | None |
| A0A094CVM5 | 28-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.