DPCstruct | MC10307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 3.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 62.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420Y521 | 76-123 | ADKLGPTVVHADGTVSRIANWAEMTEIERRNTLRVLGKRNQIRLEALR |
| A0A0A1T3V1 | 65-119 | LSDLGPIVVNVDGTIARISNWAQMADIERETTVRMIGKRNKQRLDALKKAKAEEE |
| A0A4Q4Y7L1 | 437-490 | None |
| A0A7C8L7C3 | 128-178 | None |
| A0A1Q8RY71 | 170-224 | None |
| A0A1Y2BZQ6 | 48-104 | None |
| A0A4R8Q8V6 | 194-249 | None |
| A0A5C3EXR4 | 52-107 | None |
| A0A2P5HP55 | 231-284 | None |
| A0A2H3I9C9 | 386-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.