DPCstruct | MC10306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 147 ± 29 aa |
| Standard deviation of domain lengths | 29.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.69 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF16628- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G2FYN0 | 1-185 | MLTFIYLAYSMMALLYETVPNFEDTWIECLGDLGRYRMAIEDEDIRDREIWTEVSRYWYSKASDKAPTTGRLHHHLAILARPNAVKQ… |
| A0A0B7JV28 | 353-481 | LYETVPAFEDTWVECLGDLARYRMAIEDNDKEDREIWTGVARQWYSFASEKAPSTGRLYHHLAILARPNAVQQLYFYTKSLCVIIPF… |
| A0A3N4LEZ6 | 3-154 | None |
| W2SCU1 | 247-373 | None |
| A0A2T3AC35 | 277-463 | None |
| A0A428RZS8 | 98-225 | None |
| A0A0K6G8I5 | 202-327 | None |
| A0A1B7NQ21 | 508-661 | None |
| H1VSY5 | 5-189 | None |
| A0A165B923 | 124-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.