DPCstruct | MC10305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 237 ± 48 aa |
| Standard deviation of domain lengths | 47.66 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 67.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF21314- CL0656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5IGV6 | 18-153 | LCLQDTHAQTTVDISIESNPHFIGWYLGPTGTQALTDPNTWTTSGTYAAGCSGSACSFATLCTANTLFYNNNESLVCTSARCYTMTI… |
| A0A0B7JUS2 | 22-205 | VLTPVAQQASSTTQAPDQYAPNFIGYVSSTGSYVRITCAPELIYSSSGSYAACLNMSHTRTAIATTCVSGSMPVYPRSTVTCPETAP… |
| A0A6G1I9U8 | 9-279 | None |
| A0A6G1HM39 | 72-300 | None |
| A0A6A7AGM6 | 27-234 | None |
| A0A2B7WQW5 | 452-648 | None |
| A0A2S7Y7N9 | 20-273 | None |
| A0A6A5QNX3 | 3-250 | None |
| A0A423WEU9 | 3-373 | None |
| Q2H1Z0 | 217-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.