DPCstruct | MC10300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 407 ± 54 aa |
| Standard deviation of domain lengths | 53.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554T8E9 | 1-517 | MTNVSSFPTPYGFFPCAGTVENAPAAAAEKESPGIGRDSKPVDAGKAHNDEARAKRSAQAPQSVDTAAAADAELAKTYAKALATRSF… |
| A0A7Y8DJ48 | 2-345 | QKNLTHWLTTGKLRAQPIPENASIEPFVGAYRTAVGDPQVQAWFKSKHLNLSTVRVYSDRVEGVVVRDGQEVQAQFSTTDGSGWWEV… |
| A0A1T1I7B5 | 1-418 | None |
| A0A7M1KPC3 | 19-413 | None |
| A0A2G0XB50 | 6-390 | None |
| A0A7T4RMV5 | 361-794 | None |
| A0A0D0SKU0 | 1-461 | None |
| A0A8B4I964 | 23-452 | None |
| A0A7D5LNV5 | 1-354 | None |
| A0A3M5QBV0 | 50-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.