DPCstruct | MC1030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 340 ± 40 aa |
| Standard deviation of domain lengths | 40.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.93 |
| Pfam Score | 76.67 |
| Assigned Pfam label(s) | CL0433- CL0666 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2MC83 | 1-270 | MRTALSLTQSQHVKLHDSASGKRWVQRGPALLVPEPTWEVDGGVRTAISLSSMQYVRLIDQASGAIRVEKGEQMVFLTATESILNDE… |
| A0A6B2L593 | 2-374 | HVLDSNTNVVRVEVGPMTYRCLDQETAIYGPAKMVVIPPHHYVLIANPVITTETHGKKEVALDQHGQALLRHGEQEVRLEQDPFPLY… |
| A0A7J7ZXN8 | 1-334 | None |
| A0A813FVX3 | 97-402 | None |
| A0A267FM30 | 24-384 | None |
| F4PZ19 | 86-479 | None |
| A0A6G3Z6Z4 | 28-347 | None |
| A0A126QSX5 | 19-378 | None |
| S9V8K2 | 32-369 | None |
| A0A7R8CAS3 | 42-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.