DPCstruct | MC103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Standard deviation of domain lengths | 11.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04120 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3YYL0 | 7-127 | FLRFSHTVSRLAGKPITFAAACILILLWAVAGPVFGYSETWQLVVNTATTIITFLMVFVLQNTQNRDGEAVQAKLDELIYALREADN… |
| A0A2S0IAS7 | 27-152 | PVSHFFDRFASLVTKWAGSPVAFGIALIAVVIWATSGPVFGFSETWQLVINTGTTIITFLMVFLIQQSQNKDSEALHLKLDELLIAV… |
| A0A1H7J191 | 7-129 | None |
| A0A6I2GIU2 | 1-116 | None |
| A0A7Y9IVE5 | 27-151 | None |
| A0A4Q1VEK8 | 17-121 | None |
| A0A258G0L5 | 4-124 | None |
| A0A1H7ESC4 | 3-146 | None |
| A0A4Q5X014 | 4-148 | None |
| A0A7X1TZE5 | 8-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.