DPCstruct | MC10299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 97 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090VBV7 | 5-94 | PSVGFQIRTLPVGYKRVNFNNRSYYAHNGIYFVKVNNYYEVITPEIGTVVYELPEDVEKVTIDGARYYEFNNVLYEKIQVDGTRAYE… |
| A0A371JMC8 | 11-101 | VRAFPPRGFRLRALPITAVALTVRGVNYNYADGVFYRTVEGEYEIATPPVGAVVNELPKDAEEIDFDGISAYELNEAIYKVVEDGYE… |
| A0A077F7F2 | 102-202 | None |
| A0A355J324 | 7-122 | None |
| A0A3M1GKW5 | 37-129 | None |
| A0A2N6A0S7 | 59-144 | None |
| A0A5R9L946 | 17-119 | None |
| A0A7V2JQQ6 | 59-156 | None |
| A0A147GSD7 | 139-226 | None |
| A0A367GNJ2 | 6-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.