DPCstruct | MC10298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 10.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0CC80 | 2-109 | LGGRHARANTEVHDVVFAVAPTIEQSYEQLRQQWFGEPTGLHLDSWMTVDGVEQWQVRLSTEAPPADAPKLYFVNLGGYVAGAFGED… |
| A0A7D5RZ43 | 2-118 | KLFAVLLGGRAKGCNIELHDVVFVAGNSLEETYPHLINLWFGMTKRLHIDASIELSNVDGYRIVLSQQETPAGQNKFLFFVNFGAYR… |
| A0A1M3CUH1 | 3-119 | None |
| A0A3E1K5N7 | 18-143 | None |
| A0A844LZ37 | 2-133 | None |
| A0A5Q4GPB6 | 1-123 | None |
| A0A1W9F6F7 | 2-98 | None |
| A0A4Q3CFB9 | 58-175 | None |
| A0A1H9ZA94 | 15-129 | None |
| A0A7J7BRY4 | 2-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.