DPCstruct | MC10297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 95 ± 17 aa |
| Standard deviation of domain lengths | 17.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3F154 | 1-77 | MPLYEYRCAACGHRFDHWFATFQAAEEEEDSLACPTCGSSSVSRLFSRVAIHVAGEASDSDDSSESKEEEPVEEKPK |
| A0A359LGW7 | 1-83 | MPIYEYECKNCGHRFEHLQKMTDEPPHTCPECGKEQLVKLVSNTSFQLKGTGWYATDFKNPAPKKTENTNKLETKTKETTTSE |
| A0A2V7I2A8 | 4-96 | None |
| A0A2E2ZIC9 | 17-133 | None |
| A0A538A564 | 14-112 | None |
| A0A534WKG1 | 1-85 | None |
| A0A2E8K1U4 | 1-86 | None |
| A0A3A0BH58 | 7-110 | None |
| A0A7Z9G916 | 2-69 | None |
| A0A1H7L3M3 | 35-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.