DPCstruct | MC10295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 321 ± 47 aa |
| Standard deviation of domain lengths | 47.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 24.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7T2C2 | 9-305 | KKKDHLGFEYAEHCYLGDAIKLTLSDGSVVLGKDHLFKLDNGLNVTYGEINGLAGDFYGTSNPICKGANSTEQTTRFVDAYNTLAKP… |
| A0A318ZX80 | 13-312 | EWQSPDHILLGDALELKGVAGKARPAKDVRFALPNGLELTYGEINALAGDFYGTWDPISDPDDPGERTNRFNRAWETLALGGDGLKE… |
| A0A6A6U479 | 28-291 | None |
| A0A0W0VPH4 | 32-311 | None |
| A0A2B4R1H0 | 56-359 | None |
| A0A7W1A1P0 | 1-258 | None |
| A0A850B4V9 | 110-477 | None |
| A0A074YUP3 | 17-406 | None |
| A0A842YAX1 | 2-322 | None |
| A0A496XQU6 | 33-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.