DPCstruct | MC10294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 9.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09796 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4WQL8 | 8-90 | MKRIHYPTYKSPYGPKYHYQPHVAGLSLKQLSTLGMKSAAFGGVALFTVLYYASGIPRVQRDILQKLPVIGNNFVHEIPASDN |
| A0A318ZT55 | 15-93 | AGGYRSPFGPKYSTPLHWHGLTARSAVTAGTIAAGFGVSAGTFLLFFFGEVPRVRRDILQKLPFLDEYFDRTVAPEDNP |
| A0A2B7X597 | 125-206 | None |
| F2SQK7 | 63-152 | None |
| A0A225AAS4 | 10-98 | None |
| Q2U055 | 1-70 | None |
| A0A1E3PJF1 | 1-79 | None |
| A0A2C5XAD5 | 32-135 | None |
| A0A2B7Z1T7 | 1-77 | None |
| A0A7D8Z1I8 | 8-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.