DPCstruct | MC10291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 199 ± 31 aa |
| Standard deviation of domain lengths | 31.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8LXS8 | 217-359 | MDYLLNQLQYNSIAEFISVYFQQIPRGSMDIFTARHKLSLRAFLQGQTQVKPVHLVELMFNHRYSFPSHKCADKEFHRQTAYSTSIV… |
| A0A167VTA6 | 31-217 | MDSISSVLSSQPKLRQAKRTVYEKLDAVLAAMKVFDSLGEFLSVLFYSHPNKSNKVDPRTARHVSVVSAFLQGTSGIHMGHIIDLIY… |
| A0A284S5W2 | 6-177 | None |
| A0A0C9WKN5 | 12-190 | None |
| A0A0C9WIL6 | 49-219 | None |
| A0A4S8LVS8 | 53-272 | None |
| A0A4S8LSM1 | 90-318 | None |
| A0A4S8LRY6 | 121-305 | None |
| A0A4S8LQ95 | 75-322 | None |
| A0A4V4HD74 | 71-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.