DPCstruct | MC1029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 319 ± 43 aa |
| Standard deviation of domain lengths | 43.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0L1U2 | 25-300 | NCNFEGSFRIKKETFTICGTIHPKMNTYYPPPKLIYSKNQYLSSHLQKCIRRMDDVKSVQTAKHFLDLDCSSFLRRLPIIMLEDVTI… |
| A0A6B2L588 | 40-322 | SYKVELLKSALQKCVRRRKAESAVRVGWQLLCQDPDQLLRRLPIIILEDGCLHRHFSYIVWLMVATSKGWKLSKSQVVLILRVIFEV… |
| A0A5B8MEC5 | 41-342 | None |
| A0A7S1D3C7 | 177-526 | None |
| A0A6A5CC03 | 196-527 | None |
| A0A7S3VG54 | 222-574 | None |
| A0A6C0LTW1 | 39-367 | None |
| A0A7S1WBT6 | 51-397 | None |
| A0A830HCM8 | 286-673 | None |
| C1E065 | 2-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.