DPCstruct | MC10288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 327 ± 83 aa |
| Standard deviation of domain lengths | 83.41 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2GPZ9 | 117-287 | PPVEREGRVVDWQGVVDLIVARYADRLKYMADRVESLAWMQGEVNGLLNTHIDYSEEDDGYQAALGRCTRYYTRVVVPDTQEDHLIL… |
| A0A166WSV5 | 49-385 | GDLERGKMLCEWGRQYGIEGFVREEATYEPPARWSPPDMSPWMTPYGEWHQWSMYRAASWHHTRPDTRVTVHPEYLVTLYDPVYSSL… |
| A0A0F4YMH4 | 24-466 | None |
| V2XF08 | 42-309 | None |
| A0A2N5V6A3 | 138-448 | None |
| A0A0L1JGX2 | 295-682 | None |
| A0A146IMP8 | 119-533 | None |
| A0A2S4L4G4 | 3-271 | None |
| R1GIL7 | 17-357 | None |
| M5G403 | 105-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.